Anti GNAO1 pAb (ATL-HPA040878 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA040878-25

Protein Description: guanine nucleotide binding protein (G protein), alpha activating activity polypeptide O
Gene Name: GNAO1
Alternative Gene Name: G-ALPHA-o
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000031748: 95%, ENSRNOG00000019482: 97%
Entrez Gene ID: 2775
Uniprot ID: P09471
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF
• Gene Sequence: IQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECF
• Gene ID - Mouse: ENSMUSG00000031748
• Gene ID - Rat: ENSRNOG00000019482
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.