Anti GM2A pAb (ATL-HPA008063 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA008063-25

Protein Description: GM2 ganglioside activator
Gene Name: GM2A
Alternative Gene Name: SAP-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000594: 72%, ENSRNOG00000052219: 72%
Entrez Gene ID: 2760
Uniprot ID: P17900
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA
• Gene Sequence: EPDPIIVPGNVTLSVMGSTSVPLSSPLKVDLVLEKEVAGLWIKIPCTDYIGSCTFEHFCDVLDMLIPTGEPCPEPLRTYGLPCHCPFKEGTYSLPKSEFVVPDLELPSWLTTGNYRIESVLSSSGKRLGCIKIAA
• Gene ID - Mouse: ENSMUSG00000000594
• Gene ID - Rat: ENSRNOG00000052219
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti GM2A pAb (ATL-HPA008063 w/enhanced validation) – 1 Found

Kitakaze, Keisuke; Tasaki, Chikako; Tajima, Youichi; Hirokawa, Takatsugu; Tsuji, Daisuke; Sakuraba, Hitoshi; Itoh, Kohji. Combined replacement effects of human modified β-hexosaminidase B and GM2 activator protein on GM2 gangliosidoses fibroblasts. Biochemistry And Biophysics Reports. 2016;7( 28955902):157-163.