Anti GLIPR1L2 pAb (ATL-HPA039795 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA039795-25

Protein Description: GLI pathogenesis-related 1 like 2
Gene Name: GLIPR1L2
Alternative Gene Name: MGC39497
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020214: 69%, ENSRNOG00000049053: 75%
Entrez Gene ID: 144321
Uniprot ID: Q4G1C9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTAS
• Gene Sequence: DEEDVDFINEYVNLHNELRGDVIPRGSNLRFMTWDVALSRTARAWGKKCLFTHNIYLQDVQMVHPKFYGIGENMWVGPENEFTAS
• Gene ID - Mouse: ENSMUSG00000020214
• Gene ID - Rat: ENSRNOG00000049053
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.