Anti GIPC1 pAb (ATL-HPA043958 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA043958-25

Protein Description: GIPC PDZ domain containing family, member 1
Gene Name: GIPC1
Alternative Gene Name: C19orf3, GIPC, GLUT1CBP, Hs.6454, NIP, RGS19IP1, SEMCAP, SYNECTIN, TIP-2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000019433: 98%, ENSRNOG00000003864: 97%
Entrez Gene ID: 10755
Uniprot ID: O14908
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
• Gene Sequence: EAINGQSLLGCRHYEVARLLKELPRGRTFTLKLTEPRKAFDMISQRSAGGRPGSGPQLGTGR
• Gene ID - Mouse: ENSMUSG00000019433
• Gene ID - Rat: ENSRNOG00000003864
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.