Anti GINM1 pAb (ATL-HPA017210)

Atlas Antibodies

SKU: ATL-HPA017210-100

• 
• 

Protein Description: glycoprotein integral membrane 1
Gene Name: GINM1
Alternative Gene Name: C6orf72, dJ12G14.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040006: 77%, ENSRNOG00000015239: 81%
Entrez Gene ID: 116254
Uniprot ID: Q9NU53
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQVYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQ
• Gene Sequence: GAPQDGIRINVTTLKDDGDISKQQVVLNITYESGQVYVNDLPVNSGVTRISCQTLIVKNENLENLEEKEYFGIVSVRILVHEWPMTSGSSLQLIVIQEEVVEIDGKQVQ
• Gene ID - Mouse: ENSMUSG00000040006
• Gene ID - Rat: ENSRNOG00000015239
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.