Anti GGA3 pAb (ATL-HPA024645)

Atlas Antibodies

SKU: ATL-HPA024645-25

• 
• 

Protein Description: golgi-associated, gamma adaptin ear containing, ARF binding protein 3
Gene Name: GGA3
Alternative Gene Name: KIAA0154
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020740: 79%, ENSRNOG00000027057: 82%
Entrez Gene ID: 23163
Uniprot ID: Q9NZ52
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK
• Gene Sequence: HHLDALDQLLEEAKVTSGLVKPTTSPLIPTTTPARPLLPFSTGPGSPLFQPLSFQSQGSPPKGPELSLASIHVPLESIKPSSALPVTAYDK
• Gene ID - Mouse: ENSMUSG00000020740
• Gene ID - Rat: ENSRNOG00000027057
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.