Anti GFRA3 pAb (ATL-HPA020731 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA020731-25

Protein Description: GDNF family receptor alpha 3
Gene Name: GFRA3
Alternative Gene Name: GFRa-3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024366: 69%, ENSRNOG00000020309: 72%
Entrez Gene ID: 2676
Uniprot ID: O60609
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
• Gene Sequence: LPTESRLMNSCLQARRKCQADPTCSAAYHHLDSCTSSISTPLPSEEPSVPADCLEAAQQLRNSSLIGCMCHRRMKNQVACL
• Gene ID - Mouse: ENSMUSG00000024366
• Gene ID - Rat: ENSRNOG00000020309
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.