Anti GFAP pAb (ATL-HPA063513 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA063513-25

• 

Protein Description: glial fibrillary acidic protein
Gene Name: GFAP
Alternative Gene Name: FLJ45472
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000020932: 100%, ENSRNOG00000002919: 98%
Entrez Gene ID: 2670
Uniprot ID: P14136
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
• Gene Sequence: NKALAAELNQLRAKEPTKLADVYQAELRELRLRLDQLTANSARLEVERD
• Gene ID - Mouse: ENSMUSG00000020932
• Gene ID - Rat: ENSRNOG00000002919
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.