Anti GEMIN6 pAb (ATL-HPA035726 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA035726-25

Protein Description: gem (nuclear organelle) associated protein 6
Gene Name: GEMIN6
Alternative Gene Name: FLJ23459
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000055760: 86%, ENSRNOG00000027332: 84%
Entrez Gene ID: 79833
Uniprot ID: Q8WXD5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSS
• Gene Sequence: MNEGDHRVREKLMHLFTSGDCKAYSPEDLEERKNSLKKWLEKNHIPITEQGDAPRTLCVAGVLTIDPPYGPENCSSS
• Gene ID - Mouse: ENSMUSG00000055760
• Gene ID - Rat: ENSRNOG00000027332
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.