Anti GDI1 pAb (ATL-HPA049290)

Atlas Antibodies

Catalog No.: ATL-HPA049290-100

Protein Description: GDP dissociation inhibitor 1
Gene Name: GDI1
Alternative Gene Name: FLJ41411, GDIL, MRX41, MRX48, OPHN2, RABGDIA, XAP-4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015291: 100%, ENSRNOG00000056870: 100%
Entrez Gene ID: 2664
Uniprot ID: P31150
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET
• Gene Sequence: YRKFDLGQDVIDFTGHALALYRTDDYLDQPCLET
• Gene ID - Mouse: ENSMUSG00000015291
• Gene ID - Rat: ENSRNOG00000056870
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.