Anti GDF15 pAb (ATL-HPA070957)

Atlas Antibodies

Catalog No.: ATL-HPA070957-25

Protein Description: growth differentiation factor 15
Gene Name: GDF15
Alternative Gene Name: MIC-1, MIC1, NAG-1, PDF, PLAB, PTGFB
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038508: 65%, ENSRNOG00000019661: 65%
Entrez Gene ID: 9518
Uniprot ID: Q99988
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
• Gene Sequence: EVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHC
• Gene ID - Mouse: ENSMUSG00000038508
• Gene ID - Rat: ENSRNOG00000019661
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.