Anti GBE1 pAb (ATL-HPA038075 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA038075-25

Protein Description: glucan (1,4-alpha-), branching enzyme 1
Gene Name: GBE1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022707: 88%, ENSRNOG00000051232: 87%
Entrez Gene ID: 2632
Uniprot ID: Q04446
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP
• Gene Sequence: GENEGGIDKFSRGYESFGVHRCADGGLYCKEWAPGAEGVFLTGDFNGWNPFSYPYKKLDYGKWELYIPPKQNKSVLVP
• Gene ID - Mouse: ENSMUSG00000022707
• Gene ID - Rat: ENSRNOG00000051232
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.