Anti GARNL3 pAb (ATL-HPA022433 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA022433-100

• 
• 

Protein Description: GTPase activating Rap/RanGAP domain-like 3
Gene Name: GARNL3
Alternative Gene Name: bA356B19.1, DKFZp761J1523
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038860: 94%, ENSRNOG00000057044: 94%
Entrez Gene ID: 84253
Uniprot ID: Q5VVW2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHS
• Gene Sequence: LVSTDAGVLLVDDDLPSVPVFDRTLPVKQMHVLETLDLLVLRADKGKDARLFVFRLSALQKGLEGKQAGKSRSDCRENKLEKTKGCHLYAINTHHS
• Gene ID - Mouse: ENSMUSG00000038860
• Gene ID - Rat: ENSRNOG00000057044
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.