Anti GAREM1 pAb (ATL-HPA042046)

Atlas Antibodies

SKU: ATL-HPA042046-25

• 

Protein Description: GRB2 associated regulator of MAPK1 subtype 1
Gene Name: GAREM1
Alternative Gene Name: C18orf11, FAM59A, FLJ21610, GAREM
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042680: 86%, ENSRNOG00000018194: 24%
Entrez Gene ID: 64762
Uniprot ID: Q9H706
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GNSEVNLHGCRDLGGDWAPFPHDILPYQDSGDSGSDYLFPEASEESAGIPGKSELPYEELWLEEGKPSHQPLTRSLSEKNRCDQFRGSVRSKCATSPLPIP
• Gene Sequence: GNSEVNLHGCRDLGGDWAPFPHDILPYQDSGDSGSDYLFPEASEESAGIPGKSELPYEELWLEEGKPSHQPLTRSLSEKNRCDQFRGSVRSKCATSPLPIP
• Gene ID - Mouse: ENSMUSG00000042680
• Gene ID - Rat: ENSRNOG00000018194
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.