Anti GALT pAb (ATL-HPA004868 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA004868-25

Protein Description: galactose-1-phosphate uridylyltransferase
Gene Name: GALT
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036073: 92%, ENSRNOG00000014766: 91%
Entrez Gene ID: 2592
Uniprot ID: P07902
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSD
• Gene Sequence: RANDHQHIRYNPLQDEWVLVSAHRMKRPWQGQVEPQLLKTVPRHDPLNPLCPGAIRANGEVNPQYDSTFLFDNDFPALQPDAPSPGPSDHPLFQAKSARGVCKVMCFHPWSD
• Gene ID - Mouse: ENSMUSG00000036073
• Gene ID - Rat: ENSRNOG00000014766
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.