Anti GADD45GIP1 pAb (ATL-HPA071910)

Atlas Antibodies

SKU: ATL-HPA071910-25

• 

Protein Description: GADD45G interacting protein 1
Gene Name: GADD45GIP1
Alternative Gene Name: CKBBP2, CKbetaBP2, CRIF1, MGC4667, MGC4758, PLINP-1, Plinp1, PRG6
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033751: 76%, ENSRNOG00000003011: 76%
Entrez Gene ID: 90480
Uniprot ID: Q8TAE8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: WPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPE
• Gene Sequence: WPDPEDLLTPRWQLGPRYAAKQFARYGAASGVVPGSLWPSPE
• Gene ID - Mouse: ENSMUSG00000033751
• Gene ID - Rat: ENSRNOG00000003011
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.