Anti FRMPD3 pAb (ATL-HPA003164)

Atlas Antibodies

SKU: ATL-HPA003164-25

• 

Protein Description: FERM and PDZ domain containing 3
Gene Name: FRMPD3
Alternative Gene Name: KIAA1817, RP5-1070B1.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000042425: 95%, ENSRNOG00000056221: 94%
Entrez Gene ID: 84443
Uniprot ID: Q5JV73
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQVESGL
• Gene Sequence: MMKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMLTLQDRLSLRFIEHFALVLEYAGPEQNHKFLLLQDKQPLAYVVQRTHYHGMKCLFRISFFPKDPVELLRRDPAAFEYLYIQVESGL
• Gene ID - Mouse: ENSMUSG00000042425
• Gene ID - Rat: ENSRNOG00000056221
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.