Anti FRMD8 pAb (ATL-HPA005506)

Atlas Antibodies

Catalog No.: ATL-HPA005506-25

Protein Description: FERM domain containing 8
Gene Name: FRMD8
Alternative Gene Name: FKSG44, FLJ90369
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024816: 85%, ENSRNOG00000020881: 88%
Entrez Gene ID: 83786
Uniprot ID: Q9BZ67
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED
• Gene Sequence: SREKHVLLGLRFQELSWDHTSPEEEEPILWLEFDGDSEGTPVNKLLKIYSKQAELMSSLIEYCIELSQAAEPAGPQDSATGSPSDPSSSLAPVQRPKLRRQGSVVSSRIQHLSTIDYVED
• Gene ID - Mouse: ENSMUSG00000024816
• Gene ID - Rat: ENSRNOG00000020881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.