Anti FOCAD pAb (ATL-HPA055015)

Atlas Antibodies

Catalog No.: ATL-HPA055015-25

Protein Description: focadhesin
Gene Name: FOCAD
Alternative Gene Name: FLJ20375, KIAA1797
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038368: 80%, ENSRNOG00000024402: 80%
Entrez Gene ID: 54914
Uniprot ID: Q5VW36
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQNAAALLGLWVTPPLIHSLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPLGSPELCPSALHGLSQAMKLPSPAHHLWSLLSEA
• Gene Sequence: NWAALLSPLMRLNFGEEIQQLCLEIMVTQAQSSQNAAALLGLWVTPPLIHSLSLNTKRYLLISAPLWIKHISDEQILGFVENLMVAVFKAASPLGSPELCPSALHGLSQAMKLPSPAHHLWSLLSEA
• Gene ID - Mouse: ENSMUSG00000038368
• Gene ID - Rat: ENSRNOG00000024402
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FOCAD pAb (ATL-HPA055015) – 1 Found

Liu, Dongjing; Ban, Hyo-Jeong; El Sergani, Ahmed M; Lee, Myoung Keun; Hecht, Jacqueline T; Wehby, George L; Moreno, Lina M; Feingold, Eleanor; Marazita, Mary L; Cha, Seongwon; Szabo-Rogers, Heather L; Weinberg, Seth M; Shaffer, John R. PRICKLE1 × FOCAD Interaction Revealed by Genome-Wide vQTL Analysis of Human Facial Traits. Frontiers In Genetics. 12( 34434215):674642.