Anti FNTA pAb (ATL-HPA018830)

Atlas Antibodies

Catalog No.: ATL-HPA018830-25

Protein Description: farnesyltransferase, CAAX box, alpha
Gene Name: FNTA
Alternative Gene Name: FPTA, PGGT1A, PTAR2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015994: 84%, ENSRNOG00000014462: 84%
Entrez Gene ID: 2339
Uniprot ID: P49354
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
• Gene Sequence: LDSPSYVLYRHFRRVLLKSLQKDLHEEMNYITAIIEEQPKNYQVWHHRRVLVEWLRDPSQELEFIADI
• Gene ID - Mouse: ENSMUSG00000015994
• Gene ID - Rat: ENSRNOG00000014462
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.