Anti FNDC8 pAb (ATL-HPA026521 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA026521-25

Protein Description: fibronectin type III domain containing 8
Gene Name: FNDC8
Alternative Gene Name: DKFZp434H2215
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018844: 53%, ENSRNOG00000008264: 52%
Entrez Gene ID: 54752
Uniprot ID: Q8TC99
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: AVLKKENFNMMNALDQLPKPFPNPKSMNRTVTTKGLPLASKGNLVNFLEDDTINLLKPLPVEDSDCSSDETSISAFSSTLLNPIKL
• Gene Sequence: AVLKKENFNMMNALDQLPKPFPNPKSMNRTVTTKGLPLASKGNLVNFLEDDTINLLKPLPVEDSDCSSDETSISAFSSTLLNPIKL
• Gene ID - Mouse: ENSMUSG00000018844
• Gene ID - Rat: ENSRNOG00000008264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.