Anti FNDC7 pAb (ATL-HPA054297)

Atlas Antibodies

Catalog No.: ATL-HPA054297-25

Protein Description: fibronectin type III domain containing 7
Gene Name: FNDC7
Alternative Gene Name: FLJ35838
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045326: 87%, ENSRNOG00000020421: 88%
Entrez Gene ID: 163479
Uniprot ID: Q5VTL7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GINYTVTLKAISATGLTADCSYQSYFSGACCPLGVKLYRLGPNGIRIYWQASRGSANYSTDLYGSKGIFTCTPSAGLSFCDVTEIPCGDVYTVMV
• Gene Sequence: GINYTVTLKAISATGLTADCSYQSYFSGACCPLGVKLYRLGPNGIRIYWQASRGSANYSTDLYGSKGIFTCTPSAGLSFCDVTEIPCGDVYTVMV
• Gene ID - Mouse: ENSMUSG00000045326
• Gene ID - Rat: ENSRNOG00000020421
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.