Anti FNBP1 pAb (ATL-HPA019635 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA019635-25

• 

Protein Description: formin binding protein 1
Gene Name: FNBP1
Alternative Gene Name: FBP17, KIAA0554
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075415: 87%, ENSRNOG00000008258: 89%
Entrez Gene ID: 23048
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ
• Gene Sequence: DYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLSLKLGATPEDFSNLPPEQ
• Gene ID - Mouse: ENSMUSG00000075415
• Gene ID - Rat: ENSRNOG00000008258
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.