Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation)
Atlas Antibodies
- SKU:
- ATL-HPA013750-100
![Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue](https://cdn11.bigcommerce.com/s-ydswqc5qsc/images/stencil/500x659/products/83019/151199/atl-hpa013750_anti-fmo3-pab-atl-hpa013750-wenhanced-validation_32828__42907.1681100933.jpg?c=2 "Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11<br/>Lane 2: Human cell line RT-4<br/>Lane 3: Human cell line U-251MG sp<br/>Lane 4: Human plasma (IgG/HSA depleted)<br/>Lane 5: Human liver tissue")
- Shipping:
- Calculated at Checkout
$554.00
Gene Name: FMO3
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026691: 76%, ENSRNOG00000003620: 79%
Entrez Gene ID: 2328
Uniprot ID: P31513
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | WB, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | IYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPK |
| Gene Sequence | IYKSVFSNSSKEMMCFPDFPFPDDFPNFMHNSKIQEYIIAFAKEKNLLKYIQFKTFVSSVNKHPDFATTGQWDVTTERDGKKESAVFDAVMVCSGHHVYPNLPK |
| Gene ID - Mouse | ENSMUSG00000026691 |
| Gene ID - Rat | ENSRNOG00000003620 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) | |
| Datasheet | Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) at Atlas Antibodies |
| Documents & Links for Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) | |
| Datasheet | Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) |
| Citations for Anti FMO3 pAb (ATL-HPA013750 w/enhanced validation) – 1 Found |
| Kim, Seok-Jo; Bale, Swarna; Verma, Priyanka; Wan, Qianqian; Ma, Feiyang; Gudjonsson, Johann E; Hazen, Stanley L; Harms, Paul W; Tsou, Pei-Suen; Khanna, Dinesh; Tsoi, Lam C; Gupta, Nilaksh; Ho, Karen J; Varga, John. Gut microbe-derived metabolite trimethylamine N-oxide activates PERK to drive fibrogenic mesenchymal differentiation. Iscience. 2022;25(7):104669. PubMed |