Anti FMO1 pAb (ATL-HPA023680)

Atlas Antibodies

Catalog No.: ATL-HPA023680-25

Protein Description: flavin containing monooxygenase 1
Gene Name: FMO1
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040181: 85%, ENSRNOG00000034191: 80%
Entrez Gene ID: 2326
Uniprot ID: Q01740
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDG
• Gene Sequence: LPTPIVTWLMERKINNWLNHANYGLIPEDRTQLKEFVLNDELPGRIITGKVFIRPSIKEVKENSVIFNNTSKEEPIDIIVFATGYTFAFPFLDESVVKVEDG
• Gene ID - Mouse: ENSMUSG00000040181
• Gene ID - Rat: ENSRNOG00000034191
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FMO1 pAb (ATL-HPA023680) – 1 Found

Rodrigues, Robim M; De Kock, Joery; Branson, Steven; Vinken, Mathieu; Meganathan, Kesavan; Chaudhari, Umesh; Sachinidis, Agapios; Govaere, Olivier; Roskams, Tania; De Boe, Veerle; Vanhaecke, Tamara; Rogiers, Vera. Human skin-derived stem cells as a novel cell source for in vitro hepatotoxicity screening of pharmaceuticals. Stem Cells And Development. 2014;23(1):44-55.