Anti FLNC pAb (ATL-HPA071007 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA071007-25

Protein Description: filamin C
Gene Name: FLNC
Alternative Gene Name: ABP-280, ABPL, FLN2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000068699: 100%, ENSRNOG00000007281: 100%
Entrez Gene ID: 2318
Uniprot ID: Q14315
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQ
• Gene Sequence: ERLTRTFTRSSHTYTRTERTEISKTRGGETKREVRVEESTQVGGDPFPAVFGDFLGRERLGSFGSITRQQEGEASSQ
• Gene ID - Mouse: ENSMUSG00000068699
• Gene ID - Rat: ENSRNOG00000007281
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.