Anti FH pAb (ATL-HPA025770 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA025770-100

Protein Description: fumarate hydratase
Gene Name: FH
Alternative Gene Name: fumarase
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026526: 99%, ENSRNOG00000003653: 100%
Entrez Gene ID: 2271
Uniprot ID: P07954
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
• Gene Sequence: DASVSFTENCVVGIQANTERINKLMNESLMLVTALNPHIGYDKAAKIAKTAHKNGSTLKETAIELGYLTAEQFDEWVKPK
• Gene ID - Mouse: ENSMUSG00000026526
• Gene ID - Rat: ENSRNOG00000003653
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.