Anti FGD2 pAb (ATL-HPA029145 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA029145-25

Protein Description: FYVE, RhoGEF and PH domain containing 2
Gene Name: FGD2
Alternative Gene Name: ZFYVE4
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024013: 58%, ENSRNOG00000000528: 63%
Entrez Gene ID: 221472
Uniprot ID: Q7Z6J4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQEL
• Gene Sequence: VTVFENSRTPEAAPRGQRLEDVHHRPECRPPESPGPREKTNVGEAVGSEPRTVSRRYLNSLKNKLSSEAWRKSCQPVTLSGSGTQEPEKKIVQEL
• Gene ID - Mouse: ENSMUSG00000024013
• Gene ID - Rat: ENSRNOG00000000528
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.