Anti FERMT3 pAb (ATL-HPA065231)

Atlas Antibodies

Catalog No.: ATL-HPA065231-25

Protein Description: fermitin family member 3
Gene Name: FERMT3
Alternative Gene Name: KIND3, MGC10966, MIG-2, MIG2B, UNC112C, URP2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024965: 84%, ENSRNOG00000021161: 84%
Entrez Gene ID: 83706
Uniprot ID: Q86UX7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
• Gene Sequence: MADSSYTSEVQAILAFLSLQRTGSGGPGNHPHGPDASAEGLNPYGLVAPRFQRKFKAKQLT
• Gene ID - Mouse: ENSMUSG00000024965
• Gene ID - Rat: ENSRNOG00000021161
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.