Anti FDXR pAb (ATL-HPA044393 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA044393-25

Protein Description: ferredoxin reductase
Gene Name: FDXR
Alternative Gene Name: ADXR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018861: 82%, ENSRNOG00000058497: 83%
Entrez Gene ID: 2232
Uniprot ID:
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYG
• Gene Sequence: MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEKQPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYG
• Gene ID - Mouse: ENSMUSG00000018861
• Gene ID - Rat: ENSRNOG00000058497
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FDXR pAb (ATL-HPA044393 w/enhanced validation) – 3 Found

Wang, Qi; Lee, Younghyun; Shuryak, Igor; Pujol Canadell, Monica; Taveras, Maria; Perrier, Jay R; Bacon, Bezalel A; Rodrigues, Matthew A; Kowalski, Richard; Capaccio, Christopher; Brenner, David J; Turner, Helen C. Development of the FAST-DOSE assay system for high-throughput biodosimetry and radiation triage. Scientific Reports. 2020;10(1):12716. 

He, Yi; Alejo, Salvador; Venkata, Prabhakar Pitta; Johnson, Jessica D; Loeffel, Ilanna; Pratap, Uday P; Zou, Yi; Lai, Zhao; Tekmal, Rajeshwar R; Kost, Edward R; Sareddy, Gangadhara R. Therapeutic Targeting of Ovarian Cancer Stem Cells Using Estrogen Receptor Beta Agonist. International Journal Of Molecular Sciences. 2022;23(13) 

Shuryak, Igor; Nemzow, Leah; Bacon, Bezalel A; Taveras, Maria; Wu, Xuefeng; Deoli, Naresh; Ponnaiya, Brian; Garty, Guy; Brenner, David J; Turner, Helen C. Machine learning approach for quantitative biodosimetry of partial-body or total-body radiation exposures by combining radiation-responsive biomarkers. Scientific Reports. 2023;13(1):949.