Anti FCER2 pAb (ATL-HPA008928 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA008928-25

• 
• 

Protein Description: Fc fragment of IgE, low affinity II, receptor for (CD23)
Gene Name: FCER2
Alternative Gene Name: CD23, CD23A, CLEC4J, FCE2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005540: 57%, ENSRNOG00000001005: 57%
Entrez Gene ID: 2208
Uniprot ID: P06734
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDP
• Gene Sequence: VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDP
• Gene ID - Mouse: ENSMUSG00000005540
• Gene ID - Rat: ENSRNOG00000001005
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.