Anti FBXO34 pAb (ATL-HPA052592)

Atlas Antibodies

Catalog No.: ATL-HPA052592-25

Protein Description: F-box protein 34
Gene Name: FBXO34
Alternative Gene Name: Fbx34, FLJ20725
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037536: 51%, ENSRNOG00000011704: 51%
Entrez Gene ID: 55030
Uniprot ID: Q9NWN3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ADEGKTKKGVLEAPDTQVNPVGSVSVDCGPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVE
• Gene Sequence: ADEGKTKKGVLEAPDTQVNPVGSVSVDCGPSRADRCSPKEDQAWDGASQDCPPLPAGVSFHIDSAELEPGSQTAVKNSNRYDVE
• Gene ID - Mouse: ENSMUSG00000037536
• Gene ID - Rat: ENSRNOG00000011704
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.