Anti FBXO18 pAb (ATL-HPA002844)

Atlas Antibodies

Catalog No.: ATL-HPA002844-25

Protein Description: F-box protein, helicase, 18
Gene Name: FBXO18
Alternative Gene Name: FBH1, Fbx18, FLJ14590
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058594: 98%, ENSRNOG00000018549: 98%
Entrez Gene ID: 84893
Uniprot ID: Q8NFZ0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: HQMTHDGYLKLWQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAK
• Gene Sequence: HQMTHDGYLKLWQLSKPSLASFDAIFVDEAQDCTPAIMNIVLSQPCGKIFVGDPHQQIYTFRGAVNALFTVPHTHVFYLTQSFRFGVEIAYVGATILDVCKRVRKKTLVGGNHQSGIRGDAK
• Gene ID - Mouse: ENSMUSG00000058594
• Gene ID - Rat: ENSRNOG00000018549
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.