Anti FAT1 pAb (ATL-HPA001869 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA001869-25

• 

Protein Description: FAT atypical cadherin 1
Gene Name: FAT1
Alternative Gene Name: CDHF7, CDHR8, FAT
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000070047: 85%, ENSRNOG00000030954: 85%
Entrez Gene ID: 2195
Uniprot ID: Q14517
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGM
• Gene Sequence: DGLGAKVSFHSLRITATDGENFATPLYINITVAASHKLVNLQCEETGVAKMLAEKLLQANKLHNQGEVEDIFFDSHSVNAHIPQFRSTLPTGIQVKENQPVGSSVIFMNSTDLDTGFNGKLVYAVSGGNEDSCFMIDMETGM
• Gene ID - Mouse: ENSMUSG00000070047
• Gene ID - Rat: ENSRNOG00000030954
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAT1 pAb (ATL-HPA001869 w/enhanced validation) – 3 Found

Caruso, Nathalie; Herberth, Balàzs; Bartoli, Marc; Puppo, Francesca; Dumonceaux, Julie; Zimmermann, Angela; Denadai, Simon; Lebossé, Marie; Roche, Stephane; Geng, Linda; Magdinier, Frederique; Attarian, Shahram; Bernard, Rafaelle; Maina, Flavio; Levy, Nicolas; Helmbacher, Françoise. Deregulation of the protocadherin gene FAT1 alters muscle shapes: implications for the pathogenesis of facioscapulohumeral dystrophy. Plos Genetics. 2013;9(6):e1003550. 

Wojtalewicz, Nathalie; Sadeqzadeh, Elham; Weiß, Jakob V; Tehrani, Mahnaz Moradian; Klein-Scory, Susanne; Hahn, Stephan; Schmiegel, Wolff; Warnken, Uwe; Schnölzer, Martina; de Bock, Charles E; Thorne, Rick F; Schwarte-Waldhoff, Irmgard. A soluble form of the giant cadherin Fat1 is released from pancreatic cancer cells by ADAM10 mediated ectodomain shedding. Plos One. 9(3):e90461. 

Li, Zhiqiang; Razavi, Pedram; Li, Qing; Toy, Weiyi; Liu, Bo; Ping, Christina; Hsieh, Wilson; Sanchez-Vega, Francisco; Brown, David N; Da Cruz Paula, Arnaud F; Morris, Luc; Selenica, Pier; Eichenberger, Emily; Shen, Ronglai; Schultz, Nikolaus; Rosen, Neal; Scaltriti, Maurizio; Brogi, Edi; Baselga, Jose; Reis-Filho, Jorge S; Chandarlapaty, Sarat. Loss of the FAT1 Tumor Suppressor Promotes Resistance to CDK4/6 Inhibitors via the Hippo Pathway. Cancer Cell. 2018;34(6):893-905.e8.