Anti FASTK pAb (ATL-HPA031621 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031621-25

Protein Description: Fas-activated serine/threonine kinase
Gene Name: FASTK
Alternative Gene Name: FAST
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028959: 91%, ENSRNOG00000027422: 33%
Entrez Gene ID: 10922
Uniprot ID: Q14296
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: GQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL
• Gene Sequence: GQAASSATTRDPAQRVVLVLRERWHFCRDGRVLLGSRALRERHLGLMGYQLLPLPFEELESQRGLPQLKSYLRQKLQAL
• Gene ID - Mouse: ENSMUSG00000028959
• Gene ID - Rat: ENSRNOG00000027422
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.