Anti FAM96A pAb (ATL-HPA063729)

Atlas Antibodies

SKU: ATL-HPA063729-25

• 
• 

Protein Description: family with sequence similarity 96, member A
Gene Name: FAM96A
Alternative Gene Name: FLJ22875
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032381: 100%, ENSRNOG00000017119: 100%
Entrez Gene ID: 84191
Uniprot ID: Q9H5X1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA
• Gene Sequence: LATLIGLCLRVKLQRCLPFKHKLEIYISEGTHSTEEDINKQINDKERVAAA
• Gene ID - Mouse: ENSMUSG00000032381
• Gene ID - Rat: ENSRNOG00000017119
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.