Anti FAM92A pAb (ATL-HPA034760 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA034760-25

Protein Description: family with sequence similarity 92 member A
Gene Name: FAM92A
Alternative Gene Name: FAM92A1, FLJ38979
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028218: 81%, ENSRNOG00000016338: 80%
Entrez Gene ID: 137392
Uniprot ID: A1XBS5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: KTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQEAGWAATCQTLI
• Gene Sequence: KTIFSEFITIEMLFHGKALEVYTAAYQNIQNIDEDEDLEVFRNSLYAPDYSSRLDIVRANSKSPLQRSLSAKCVSGTGQEAGWAATCQTLI
• Gene ID - Mouse: ENSMUSG00000028218
• Gene ID - Rat: ENSRNOG00000016338
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM92A pAb (ATL-HPA034760 w/enhanced validation) – 2 Found

Schrauwen, Isabelle; Giese, Arnaud Pj; Aziz, Abdul; Lafont, David Tino; Chakchouk, Imen; Santos-Cortez, Regie Lyn P; Lee, Kwanghyuk; Acharya, Anushree; Khan, Falak Sher; Ullah, Asmat; Nickerson, Deborah A; Bamshad, Michael J; Ali, Ghazanfar; Riazuddin, Saima; Ansar, Muhammad; Ahmad, Wasim; Ahmed, Zubair M; Leal, Suzanne M. FAM92A Underlies Nonsyndromic Postaxial Polydactyly in Humans and an Abnormal Limb and Digit Skeletal Phenotype in Mice. Journal Of Bone And Mineral Research : The Official Journal Of The American Society For Bone And Mineral Research. 2019;34(2):375-386. 

Wang, Liang; Yan, Ziyi; Vihinen, Helena; Eriksson, Ove; Wang, Weihuan; Soliymani, Rabah; Lu, Yao; Xue, Yaxin; Jokitalo, Eija; Li, Jing; Zhao, Hongxia. FAM92A1 is a BAR domain protein required for mitochondrial ultrastructure and function. The Journal Of Cell Biology. 2019;218(1):97-111.