Anti FAM8A1 pAb (ATL-HPA073675)

Atlas Antibodies

SKU: ATL-HPA073675-25

• 

Protein Description: family with sequence similarity 8 member A1
Gene Name: FAM8A1
Alternative Gene Name: AHCP
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000069237: 67%, ENSRNOG00000026120: 69%
Entrez Gene ID: 51439
Uniprot ID: Q9UBU6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET
• Gene Sequence: NPFYFLSPGAAGPDPRTAAGISTPAPVAGLGPRAPHVQASVRATPVTRVGSAAPSRSPSET
• Gene ID - Mouse: ENSMUSG00000069237
• Gene ID - Rat: ENSRNOG00000026120
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.