Anti FAM83H pAb (ATL-HPA024604 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA024604-25

• 

Protein Description: family with sequence similarity 83, member H
Gene Name: FAM83H
Alternative Gene Name: FLJ46072
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000046761: 82%, ENSRNOG00000030264: 82%
Entrez Gene ID: 286077
Uniprot ID: Q6ZRV2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: VVSQAWREEVAAPGAVGGERRSLESCLLDLRDSFAQQLHQEAERQPGAASLTAAQLLDTLGRSGSDRLPSRFLSAQSHSTSPQGLDSPLPLEGS
• Gene Sequence: VVSQAWREEVAAPGAVGGERRSLESCLLDLRDSFAQQLHQEAERQPGAASLTAAQLLDTLGRSGSDRLPSRFLSAQSHSTSPQGLDSPLPLEGS
• Gene ID - Mouse: ENSMUSG00000046761
• Gene ID - Rat: ENSRNOG00000030264
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM83H pAb (ATL-HPA024604 w/enhanced validation) – 2 Found

Kuga, Takahisa; Sasaki, Mitsuho; Mikami, Toshinari; Miake, Yasuo; Adachi, Jun; Shimizu, Maiko; Saito, Youhei; Koura, Minako; Takeda, Yasunori; Matsuda, Junichiro; Tomonaga, Takeshi; Nakayama, Yuji. FAM83H and casein kinase I regulate the organization of the keratin cytoskeleton and formation of desmosomes. Scientific Reports. 2016;6( 27222304):26557. 

Kuga, Takahisa; Kume, Hideaki; Adachi, Jun; Kawasaki, Naoko; Shimizu, Maiko; Hoshino, Isamu; Matsubara, Hisahiro; Saito, Youhei; Nakayama, Yuji; Tomonaga, Takeshi. Casein kinase 1 is recruited to nuclear speckles by FAM83H and SON. Scientific Reports. 2016;6( 27681590):34472.