Anti FAM83B pAb (ATL-HPA031464 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA031464-25

Protein Description: family with sequence similarity 83, member B
Gene Name: FAM83B
Alternative Gene Name: C6orf143, FLJ30642
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032358: 82%, ENSRNOG00000011925: 82%
Entrez Gene ID: 222584
Uniprot ID: Q5T0W9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ALGDRFEGYDNPENLKANALYTHSRLRSSLVFKPTLPEQKEVNSCTTGSSNSTIIGSQGSETPKEVPDTPTNVQHLTDKPLPESIPKLPLQS
• Gene Sequence: ALGDRFEGYDNPENLKANALYTHSRLRSSLVFKPTLPEQKEVNSCTTGSSNSTIIGSQGSETPKEVPDTPTNVQHLTDKPLPESIPKLPLQS
• Gene ID - Mouse: ENSMUSG00000032358
• Gene ID - Rat: ENSRNOG00000011925
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM83B pAb (ATL-HPA031464 w/enhanced validation) – 3 Found

Richtmann, Sarah; Wilkens, Dennis; Warth, Arne; Lasitschka, Felix; Winter, Hauke; Christopoulos, Petros; Herth, Felix J F; Muley, Thomas; Meister, Michael; Schneider, Marc A. FAM83A and FAM83B as Prognostic Biomarkers and Potential New Therapeutic Targets in NSCLC. Cancers. 2019;11(5) 

Okabe, Naoyuki; Ezaki, Junji; Yamaura, Takumi; Muto, Satoshi; Osugi, Jun; Tamura, Hirosumi; Imai, Jun-Ichi; Ito, Emi; Yanagisawa, Yuka; Honma, Reiko; Gotoh, Mitsukazu; Watanabe, Shinya; Waguri, Satoshi; Suzuki, Hiroyuki. FAM83B is a novel biomarker for diagnosis and prognosis of lung squamous cell carcinoma. International Journal Of Oncology. 2015;46(3):999-1006. 

Yamaura, Takumi; Ezaki, Junji; Okabe, Naoyuki; Takagi, Hironori; Ozaki, Yuki; Inoue, Takuya; Watanabe, Yuzuru; Fukuhara, Mitsuro; Muto, Satoshi; Matsumura, Yuki; Hasegawa, Takeo; Hoshino, Mika; Osugi, Jun; Shio, Yutaka; Waguri, Satoshi; Tamura, Hirosumi; Imai, Jun-Ichi; Ito, Emi; Yanagisawa, Yuka; Honma, Reiko; Watanabe, Shinya; Suzuki, Hiroyuki. Family with sequence similarity 83, member B is a predictor of poor prognosis and a potential therapeutic target for lung adenocarcinoma expressing wild-type epidermal growth factor receptor. Oncology Letters. 2018;15(2):1549-1558.