Anti FAM234A pAb (ATL-HPA071871)

Atlas Antibodies

Catalog No.: ATL-HPA071871-25

Protein Description: family with sequence similarity 234 member A
Gene Name: FAM234A
Alternative Gene Name: C16orf9, DKFZP761D0211, FLJ32603, ITFG3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024187: 69%, ENSRNOG00000016502: 27%
Entrez Gene ID: 83986
Uniprot ID: Q9H0X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: REEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRM
• Gene Sequence: REEVSGHLYSGSTGHQIGLRGSLGVDGESGFLLHVTRTGAHYILFPCASSLCGCSVKGLYEKVTGSGGPFKSDPHWESMLNATTRRM
• Gene ID - Mouse: ENSMUSG00000024187
• Gene ID - Rat: ENSRNOG00000016502
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.