Anti FAM204A pAb (ATL-HPA038182)

Atlas Antibodies

SKU: ATL-HPA038182-25

• 
• 

Protein Description: family with sequence similarity 204, member A
Gene Name: FAM204A
Alternative Gene Name: bA319I23.1, C10orf84, FLJ13188
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000057858: 62%, ENSRNOG00000009830: 55%
Entrez Gene ID: 63877
Uniprot ID: Q9H8W3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPID
• Gene Sequence: MWSGLLPPGLNESDAESNSEDEATLENSGLNLQEDKEDESIRKTEIIDFSTDEPKTETESNVNAYEECPSGIPID
• Gene ID - Mouse: ENSMUSG00000057858
• Gene ID - Rat: ENSRNOG00000009830
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.