Anti FAM196A pAb (ATL-HPA035898)

Atlas Antibodies

Catalog No.: ATL-HPA035898-25

Protein Description: family with sequence similarity 196, member A
Gene Name: FAM196A
Alternative Gene Name: C10orf141, FLJ45557
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000073805: 76%, ENSRNOG00000033881: 77%
Entrez Gene ID: 642938
Uniprot ID: Q6ZSG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PSETALACSPPMQCLSPECSEQPSQTHTPPGLGNQPSPTAVAAGEECQRIVPHTEVVDLKAQLQMMENLISSSQETIKVLLGVIQELEKGEAHREGLS
• Gene Sequence: PSETALACSPPMQCLSPECSEQPSQTHTPPGLGNQPSPTAVAAGEECQRIVPHTEVVDLKAQLQMMENLISSSQETIKVLLGVIQELEKGEAHREGLS
• Gene ID - Mouse: ENSMUSG00000073805
• Gene ID - Rat: ENSRNOG00000033881
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.