Anti FAM189A2 pAb (ATL-HPA057207)

Atlas Antibodies

Catalog No.: ATL-HPA057207-25

Protein Description: family with sequence similarity 189, member A2
Gene Name: FAM189A2
Alternative Gene Name: C9orf61, X123
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000071604: 65%, ENSRNOG00000061147: 64%
Entrez Gene ID: 9413
Uniprot ID: Q15884
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEER
• Gene Sequence: MSEGSEAAVIPLDLGCTQVTQDGDIPNIPAEENASTSTPSSTLVRPIRSRRALPPLRTRSKSDPVLHPSEER
• Gene ID - Mouse: ENSMUSG00000071604
• Gene ID - Rat: ENSRNOG00000061147
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.