Anti FAM187A pAb (ATL-HPA022794)

Atlas Antibodies

Catalog No.: ATL-HPA022794-25

Protein Description: family with sequence similarity 187, member A
Gene Name: FAM187A
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000075510: 85%, ENSRNOG00000002918: 87%
Entrez Gene ID: 388389
Uniprot ID: A6NFU0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: EIVEKENIFQRTPCPAFLMFENAAYLADMSFELPCHCKPEEVPAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLTRFSIRMFSLLV
• Gene Sequence: EIVEKENIFQRTPCPAFLMFENAAYLADMSFELPCHCKPEEVPAVVWFYQKHLGSSHTKVLTDFDGRVLTEAAQVRVGSDMLTRFSIRMFSLLV
• Gene ID - Mouse: ENSMUSG00000075510
• Gene ID - Rat: ENSRNOG00000002918
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.