Anti FAM185A pAb (ATL-HPA029883)

Atlas Antibodies

Catalog No.: ATL-HPA029883-25

Protein Description: family with sequence similarity 185, member A
Gene Name: FAM185A
Alternative Gene Name: MGC35361
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001761: 36%, ENSRNOG00000008332: 38%
Entrez Gene ID: 222234
Uniprot ID: Q8N0U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPP
• Gene Sequence: PCSGWELGCFRLCLRQVRLWAGAGRWACWACQARPYSSGGSERWPGSETEVPPP
• Gene ID - Mouse: ENSMUSG00000001761
• Gene ID - Rat: ENSRNOG00000008332
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.