Anti FAM181B pAb (ATL-HPA066861)

Atlas Antibodies

SKU: ATL-HPA066861-25

• 
• 

Protein Description: family with sequence similarity 181, member B
Gene Name: FAM181B
Alternative Gene Name: LOC220382, MGC33846
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051515: 43%, ENSRNOG00000010763: 66%
Entrez Gene ID: 220382
Uniprot ID: A6NEQ2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP
• Gene Sequence: PLDVFPAGASVLRGPPELEPGLFEPPPAVVGNLLYPEPWSVPGCSPTKKSPLTAPRGGLTLNEPLSPLYPAAADSP
• Gene ID - Mouse: ENSMUSG00000051515
• Gene ID - Rat: ENSRNOG00000010763
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.