Anti FAM174A pAb (ATL-HPA019539 w/enhanced validation)

Atlas Antibodies

Catalog No.: ATL-HPA019539-25

Protein Description: family with sequence similarity 174, member A
Gene Name: FAM174A
Alternative Gene Name: TMEM157, UNQ1912
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051185: 100%, ENSRNOG00000019087: 100%
Entrez Gene ID: 345757
Uniprot ID: Q8TBP5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
• Gene Sequence: RRNRKTRRYGVLDTNIENMELTPLEQDDEDDDNTLFDANHPRR
• Gene ID - Mouse: ENSMUSG00000051185
• Gene ID - Rat: ENSRNOG00000019087
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.