Anti FAM168B pAb (ATL-HPA043778 w/enhanced validation)

Atlas Antibodies

SKU: ATL-HPA043778-25

• 

Protein Description: family with sequence similarity 168, member B
Gene Name: FAM168B
Alternative Gene Name: KIAA0280L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037503: 97%, ENSRNOG00000023467: 97%
Entrez Gene ID: 130074
Uniprot ID: A1KXE4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP
• Gene Sequence: MNPVYSPGSSGVPYANAKGIGYPAGFPMGYAAAAPAYSPNMYPGANPTFQTGYTPGTPYKVSCSPTSGAVPPYSSSP
• Gene ID - Mouse: ENSMUSG00000037503
• Gene ID - Rat: ENSRNOG00000023467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.