Anti FAM168A pAb (ATL-HPA037580)

Atlas Antibodies

Catalog No.: ATL-HPA037580-25

Protein Description: family with sequence similarity 168, member A
Gene Name: FAM168A
Alternative Gene Name: KIAA0280, TCRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029461: 100%, ENSRNOG00000018873: 99%
Entrez Gene ID: 23201
Uniprot ID: Q92567
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: WB, ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPEFQFLHSAYATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTY
• Gene Sequence: MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPEFQFLHSAYATLLMKQAWPQNSSSCGTEGTFHLPVDTGTENRTY
• Gene ID - Mouse: ENSMUSG00000029461
• Gene ID - Rat: ENSRNOG00000018873
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Citations for Anti FAM168A pAb (ATL-HPA037580) – 2 Found

Wang, C; Liu, H; Qiu, Q; Zhang, Z; Gu, Y; He, Z. TCRP1 promotes NIH/3T3 cell transformation by over-activating PDK1 and AKT1. Oncogenesis. 2017;6(4):e323. 

Zhao, Shuai; Li, Xiaohua; Yin, Lei; Hou, Lili; Lan, Jing; Zhu, Xun. TCRP1 induces tamoxifen resistance by promoting the activation of SGK1 in MCF‑7 cells. Oncology Reports. 2020;43(6):2017-2027.